Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JC polyomavirus Small t antigen Protein

This JC polyomavirus Small t antigen Protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ST) (ST-AG)

UniProt

P03083

Expression Region

1-172aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

JC polyomavirus (JCPyV) (JCV)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALHCWEKVLGDTPYRDLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp4f14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3912905 3x 1.0 µg

Cyp4f14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cow Thromboxane-A synthase (TBXAS1) ELISA Kit
abx515299 96 Tests

Cow Thromboxane-A synthase (TBXAS1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Acsm1 shRNA (UAS) - Lentiviral mouse Acsm1 shRNA (UAS, RFP) (25)
GTR15190739 1 Vial

Lentiviral mouse Acsm1 shRNA (UAS) - Lentiviral mouse Acsm1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MGMT Antibody
MBS9215442-01 0.05 mL

MGMT Antibody

Sign In for Pricing
View Details
MGMT Antibody
MBS9215442-02 0.2 mL

MGMT Antibody

Sign In for Pricing
View Details
MGMT Antibody
MBS9215442-03 5x 0.2 mL

MGMT Antibody

Sign In for Pricing
View Details