Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Tgfa Protein

This Rat Tgfa Protein spans the amino acid sequence from region 24-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P01134

Expression Region

24-159aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF662 Rabbit Polyclonal Antibody (FITC)
orb2111061 100 µL

ZNF662 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Goat Anti-Human IgM-TXRD
MBS674577-01 1 mg

Goat Anti-Human IgM-TXRD

Sign In for Pricing
View Details
Goat Anti-Human IgM-TXRD
MBS674577-02 5x 1 mg

Goat Anti-Human IgM-TXRD

Sign In for Pricing
View Details
2-N,2-N,3-N-Trimethylpyridine-2,3-diamine
RDC33391-01 50 mg

2-N,2-N,3-N-Trimethylpyridine-2,3-diamine

Sign In for Pricing
View Details
2-N,2-N,3-N-Trimethylpyridine-2,3-diamine
RDC33391-02 0.5 g

2-N,2-N,3-N-Trimethylpyridine-2,3-diamine

Sign In for Pricing
View Details
Lentiviral mouse Dnaic2 shRNA (UAS) - Lentiviral mouse Dnaic2 shRNA (UAS, GFP) plasmid
GTR15108586 1 Vial

Lentiviral mouse Dnaic2 shRNA (UAS) - Lentiviral mouse Dnaic2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details