Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human WNT1 Protein

This Human WNT1 Protein spans the amino acid sequence from region 142-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Proto-oncogene Int-1 homolog)

UniProt

P04628

Expression Region

142-288aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED6 Rabbit Polyclonal Antibody
TA365100 100 µL

MED6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human P-Cadherin (Cadherin; Placental) ELISA Kit
E-UNEL-H0329-01 5x 96 Tests

Uncoated Human P-Cadherin (Cadherin; Placental) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human P-Cadherin (Cadherin; Placental) ELISA Kit
E-UNEL-H0329-02 15x 96 Tests

Uncoated Human P-Cadherin (Cadherin; Placental) ELISA Kit

Sign In for Pricing
View Details
TRPV4 Rabbit Polyclonal Antibody
TA385470 100 µL

TRPV4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene A NH₂
HA50056002.25G 25 g

Polystyrene A NH₂

Sign In for Pricing
View Details
TMEM205 (142-151) Goat Polyclonal Antibody
AP22430PU-N 100 µg

TMEM205 (142-151) Goat Polyclonal Antibody

Sign In for Pricing
View Details