Human WNT1 Protein
This Human WNT1 Protein spans the amino acid sequence from region 142-288aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Proto-oncogene Int-1 homolog)
UniProt
P04628
Expression Region
142-288aa
Tag
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
51.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942465-500 1x 500 µL
Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042094-500 1x 500 µL
P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472131-100 1x 100 µL
Mesothelin (Mesothelial Marker) (MSLN/2131), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details