Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Coagulation factor IX Protein

This Human Coagulation factor IX Protein spans the amino acid sequence from region 144-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Christmas factor) (Plasma thromboplastin component) (PTC)

UniProt

P00740

Expression Region

144-239aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FBXL18 Antibody Picoband® Cy3 Conjugated
A14936-1-Cy3 100 µg/Vial

Anti-FBXL18 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Anti-AKT3 Antibody Picoband®, Dylight550 Conjugate
A00520-2-Dylight550 100 µg

Anti-AKT3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
C9orf150 Polyclonal Antibody, PerCP Conjugated
bs-9496R-PerCP 100 µL

C9orf150 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Bpifa2 Rat shRNA Plasmid (Locus ID 50585)
TL711719 1 Kit

Bpifa2 Rat shRNA Plasmid (Locus ID 50585)

Sign In for Pricing
View Details
4930502E18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10643094 4x 500 ng

4930502E18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
FBXL2 Protein Vector (Human) (pPM-C-His)
PV015812 500 ng

FBXL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details