Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mmp2 Protein

This Rat Mmp2 Protein spans the amino acid sequence from region 412-662aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

72KDA gelatinaseGelatinase AMatrix metalloproteinase-2 , MMP-2

UniProt

P33436

Expression Region

412-662aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK1 Antibody
MBS7050119-01 0.05 mg

CAMK1 Antibody

Sign In for Pricing
View Details
CAMK1 Antibody
MBS7050119-02 0.1 mg

CAMK1 Antibody

Sign In for Pricing
View Details
CAMK1 Antibody
MBS7050119-03 5x 0.1 mg

CAMK1 Antibody

Sign In for Pricing
View Details
TMEM215 Lentiviral Activation Particles (m)
sc-435773-LAC 200 µL

TMEM215 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Brain2 Rabbit Polyclonal Antibody (BF647)
orb1601067 100 µL

Brain2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Recombinant Human MRPL58 Protein, N-His
orb2833407-01 20 µg

Recombinant Human MRPL58 Protein, N-His

Sign In for Pricing
View Details