Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mmp2 Protein

This Rat Mmp2 Protein spans the amino acid sequence from region 412-662aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

72KDA gelatinaseGelatinase AMatrix metalloproteinase-2 , MMP-2

UniProt

P33436

Expression Region

412-662aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESRP2 (NM_024939) Human Tagged Lenti ORF Clone
RC204916L3 10 µg

ESRP2 (NM_024939) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Mafk shRNA (UAS) - Lentiviral mouse Mafk shRNA (UAS, iRFP) (25)
GTR15210338 1 Vial

Lentiviral mouse Mafk shRNA (UAS) - Lentiviral mouse Mafk shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Dog/Canine Kallikrein 8 KLK8 ELISA Kit
BG-CAN11461 1 Each

Dog/Canine Kallikrein 8 KLK8 ELISA Kit

Sign In for Pricing
View Details
Human TBL1Y ELISA KIT
ELI-29151h 96 Tests

Human TBL1Y ELISA KIT

Sign In for Pricing
View Details
Magic™ Membrane Protein Human VAMP2 (Vesicle associated membrane protein 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3680K Each

Magic™ Membrane Protein Human VAMP2 (Vesicle associated membrane protein 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Sign In for Pricing
View Details
PKC delta Rabbit Polyclonal Antibody (BF750)
orb2428375 100 µL

PKC delta Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details