Neosartorya fumigata Allergen Asp f 15 Protein
This Neosartorya fumigata Allergen Asp f 15 Protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Allergen Asp f 13) (allergen Asp f 15)
UniProt
O60022
Expression Region
20-152aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
APTPENEARDAIPVSVSYDPRYDNAGTSMNDVSCSNGVNGLVTKWPTFGSVPGFARIGGAPTIPGWNSPNCGKCYKLQYEQNTIYVTAIDAAPGGFNIATSAMDQLTNGMAVELGRVQATYEEADPSHCASGV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681081-500 1x 500 µL
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880525-100 1x 100 µL
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details