Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Enho Protein

This Mouse Enho Protein spans the amino acid sequence from region 34-76aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Energy homeostasis-associated protein)

UniProt

Q8K1D8

Expression Region

34-76aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Usp8 Pre-designed siRNA Set A
SI215725A 1 Each

Rat Usp8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
EAU 250X26RL-T1-LL-P16 Pipe Markers for Water
N001452 30 Pack (30 Marker (s) x 1 Roll)

EAU 250X26RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Substance P (4-11) (Octa-Substance P)
MBS658042-01 1 mg

Substance P (4-11) (Octa-Substance P)

Sign In for Pricing
View Details
Substance P (4-11) (Octa-Substance P)
MBS658042-02 5x 1 mg

Substance P (4-11) (Octa-Substance P)

Sign In for Pricing
View Details
Solanezumab (Anti-Amyloid Beta)
C00781-1mg*25 25x 1mg

Solanezumab (Anti-Amyloid Beta)

Sign In for Pricing
View Details
Olr932 Recombinant Protein (Rat)
RP218681 100 µg

Olr932 Recombinant Protein (Rat)

Sign In for Pricing
View Details