Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bombyx mori General odorant-binding protein 1 Protein

This Bombyx mori General odorant-binding protein 1 Protein spans the amino acid sequence from region 19-164aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GOBP1)

UniProt

P34171

Expression Region

19-164aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bombyx mori (Silk moth)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVYVMKDVTLGFGQALEQCREESQLTEEKMEEFFHFWNDDFKFEHRELGCAIQCMSRHFNLLTDSSRMHHENTDKFIKSFPNGEILSQKMIDMIHTCEKTFDSEPDHCWRILRVAECFKDACNKSGLAPSMELILAEFIMESEADK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TSHB Protein, N-His
E55P0559 50 µg

Recombinant Human TSHB Protein, N-His

Sign In for Pricing
View Details
Poly [ADP-ribose] polymerase 1 (PARP1) Bovine ELISA Kit
F9901 96 Tests

Poly [ADP-ribose] polymerase 1 (PARP1) Bovine ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Amigo1 shRNA (UAS) - Lentiviral mouse Amigo1 shRNA (UAS, GFP) plasmid
GTR15255406 1 Vial

Lentiviral mouse Amigo1 shRNA (UAS) - Lentiviral mouse Amigo1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-c-Fos Rabbit Monoclonal Antibody, Carrier-free
M00297-carrier-free 100 µL

Anti-c-Fos Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Argininosuccinate Lyase Polyclonal Antibody, APC Conjugated
bs-12515R-APC 100 µL

Argininosuccinate Lyase Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
GM130 Recombinant Antibody, Biotin Conjugated
bsm-61120R-Biotin-TR 20 µL

GM130 Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details