Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP15 Protein

This Human BMP15 Protein spans the amino acid sequence from region 268-392aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth/differentiation factor 9B

UniProt

O95972

Expression Region

268-392aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloro-4-hydroxyphenylboronic acid, pinacol ester
424974-01 100 mg

3-Chloro-4-hydroxyphenylboronic acid, pinacol ester

Sign In for Pricing
View Details
3-Chloro-4-hydroxyphenylboronic acid, pinacol ester
424974-02 250 mg

3-Chloro-4-hydroxyphenylboronic acid, pinacol ester

Sign In for Pricing
View Details
Lentiviral human RAD51 shRNA (UAS) - Lentiviral human RAD51 shRNA (UAS, iRFP) (100)
GTR15154791 1 Vial

Lentiviral human RAD51 shRNA (UAS) - Lentiviral human RAD51 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CD28 Protein, Mouse, Recombinant (His)
TMPY-01955-01 5 µg

CD28 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
CD28 Protein, Mouse, Recombinant (His)
TMPY-01955-02 10 µg

CD28 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
CD28 Protein, Mouse, Recombinant (His)
TMPY-01955-03 20 µg

CD28 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details