Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADGRG6 Protein

This Human ADGRG6 Protein spans the amino acid sequence from region 38-437aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Developmentally regulated G-protein-coupled receptor) (G-protein coupled receptor 126) (Vascular inducible G protein-coupled receptor)

UniProt

Q86SQ4

Expression Region

38-437aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CANCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNILRHPEVKVQSKVAEWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®535ST Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20824-500uL 1x 500 µL

CF®535ST Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
Zinc-Alpha-2-Glycoprotein (AZGP1) Antibody
abx036774-01 100 µg

Zinc-Alpha-2-Glycoprotein (AZGP1) Antibody

Sign In for Pricing
View Details
Zinc-Alpha-2-Glycoprotein (AZGP1) Antibody
abx036774-02 1 mg

Zinc-Alpha-2-Glycoprotein (AZGP1) Antibody

Sign In for Pricing
View Details
LRRC6, ID (LRRC6, LRTP, TSLRP, Protein TILB homolog, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, Testis-specific leucine-rich repeat protein) (MaxLight 750) discontinued
037968-ML750 100 µL

LRRC6, ID (LRRC6, LRTP, TSLRP, Protein TILB homolog, Leucine-rich repeat-containing protein 6, Leucine-rich testis-specific protein, Testis-specific leucine-rich repeat protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
5,7-Dimethoxyisoflavone
FD66629-01 50 mg

5,7-Dimethoxyisoflavone

Sign In for Pricing
View Details
5,7-Dimethoxyisoflavone
FD66629-02 100 mg

5,7-Dimethoxyisoflavone

Sign In for Pricing
View Details