Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADGRG6 Protein

This Human ADGRG6 Protein spans the amino acid sequence from region 38-437aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Developmentally regulated G-protein-coupled receptor) (G-protein coupled receptor 126) (Vascular inducible G protein-coupled receptor)

UniProt

Q86SQ4

Expression Region

38-437aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CANCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNILRHPEVKVQSKVAEWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP24 sgRNA CRISPR Lentivector (Human) (Target 3)
K1312704 1.0 µg DNA

MMP24 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E) (PE)
128161-PE 100 µL

HTR1E (5-hydroxytryptamine Receptor 1E, 5-HT-1E, 5-HT1E, S31, Serotonin Receptor 1E) (PE)

Sign In for Pricing
View Details
Viability PCR Starter Kit with PMAxxTM and Enhancer
#31076-X 1 Kit

Viability PCR Starter Kit with PMAxxTM and Enhancer

Sign In for Pricing
View Details
Mouse MRP8 AssayLite™ Antibody (FITC Conjugate)
32955-05141 2x 75 µg

Mouse MRP8 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
XAGE2 CRISPRa sgRNA lentivector (set of three targets)(Human)
50501121 3x 1.0µg DNA

XAGE2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Monoclonal VCAM-1/CD106 Antibody (OTI3H10) [Biotin]
NBP2-74840B 0.1 mL

Mouse Monoclonal VCAM-1/CD106 Antibody (OTI3H10) [Biotin]

Sign In for Pricing
View Details