Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADGRG6 Protein

This Human ADGRG6 Protein spans the amino acid sequence from region 38-437aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Developmentally regulated G-protein-coupled receptor) (G-protein coupled receptor 126) (Vascular inducible G protein-coupled receptor)

UniProt

Q86SQ4

Expression Region

38-437aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CANCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNILRHPEVKVQSKVAEWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cathepsin B (CTSB) ELISA Kit
RK06752 96 Tests

Mouse Cathepsin B (CTSB) ELISA Kit

Sign In for Pricing
View Details
Mouse Cx3cr1 activation kit by CRISPRa
GA200960 1 Kit

Mouse Cx3cr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-CD5 Antibody-APC/Cy7 labled
MBS8321356-01 25 Assays

Anti-CD5 Antibody-APC/Cy7 labled

Sign In for Pricing
View Details
Anti-CD5 Antibody-APC/Cy7 labled
MBS8321356-02 100 Assays

Anti-CD5 Antibody-APC/Cy7 labled

Sign In for Pricing
View Details
Anti-CD5 Antibody-APC/Cy7 labled
MBS8321356-03 5x 100 Assays

Anti-CD5 Antibody-APC/Cy7 labled

Sign In for Pricing
View Details
TMEM184C 3'UTR GFP Stable Cell Line
TU075896 1.0 mL

TMEM184C 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details