Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bcl2 Protein

This Mouse Bcl2 Protein spans the amino acid sequence from region 5-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P10417

Expression Region

5-205aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TFAP4 shRNA (UAS) - Lentiviral human TFAP4 shRNA (UAS, iRFP) (100)
GTR15119655 1 Vial

Lentiviral human TFAP4 shRNA (UAS) - Lentiviral human TFAP4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal B7-1/CD80 Antibody (2740B) [PE/Cy7]
FAB7401PECY7 0.1 mL

Rabbit Monoclonal B7-1/CD80 Antibody (2740B) [PE/Cy7]

Sign In for Pricing
View Details
CD45 Rabbit pAb
E47R0522 100 µL

CD45 Rabbit pAb

Sign In for Pricing
View Details
Guinea Pig Cell cycle control protein 50B (TMEM30B) ELISA Kit
GTR10354256 96 Well

Guinea Pig Cell cycle control protein 50B (TMEM30B) ELISA Kit

Sign In for Pricing
View Details
2- (1-Methylidene-3-oxo-2,3-dihydro-1H-isoindol-2-yl) acetic acid
MCA10028-01 0.5 g

2- (1-Methylidene-3-oxo-2,3-dihydro-1H-isoindol-2-yl) acetic acid

Sign In for Pricing
View Details
2- (1-Methylidene-3-oxo-2,3-dihydro-1H-isoindol-2-yl) acetic acid
MCA10028-02 5 g

2- (1-Methylidene-3-oxo-2,3-dihydro-1H-isoindol-2-yl) acetic acid

Sign In for Pricing
View Details