Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Bcl2 Protein

This Mouse Bcl2 Protein spans the amino acid sequence from region 5-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P10417

Expression Region

5-205aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prostaglandin E2 (PG-E2) Elisa Kit
EK711344 96 Well

Human Prostaglandin E2 (PG-E2) Elisa Kit

Sign In for Pricing
View Details
HIPK3 Polyclonal Antibody, RBITC Conjugated
bs-6777R-RBITC 100 µL

HIPK3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
LILRB5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1215706 1.0 µg DNA

LILRB5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Anti-IL-6/IFNb2 Antibody (CSTRI patent anti-IL-6)
F2015-1 1 mg

Anti-IL-6/IFNb2 Antibody (CSTRI patent anti-IL-6)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2166 (AF_2166), partial
MBS7070329 Inquire

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2166 (AF_2166), partial

Sign In for Pricing
View Details
CASP7 AAV Vector (Rat) (CMV)
15076106 1 µg

CASP7 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details