Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACTL6B Protein

This Human ACTL6B Protein spans the amino acid sequence from region 1-426aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

UniProt

O94805

Expression Region

1-426aa

Tag

C-terminal 6xHis-Flag-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad2/3 Mouse Monoclonal Antibody
AMM85030-01 1 Each

Smad2/3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Smad2/3 Mouse Monoclonal Antibody
AMM85030-02 50 µL

Smad2/3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Smad2/3 Mouse Monoclonal Antibody
AMM85030-03 100 µL

Smad2/3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
BNC2 Protein (N-His, Human)
P501020 100 µg

BNC2 Protein (N-His, Human)

Sign In for Pricing
View Details
MATN4 Protein Vector (Human) (pPM-C-HA)
28150022 500 ng

MATN4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Gamma-Aminobutyric Acid A Receptor Alpha 2 ELISA Kit
MBS083547 Inquire

Rabbit Gamma-Aminobutyric Acid A Receptor Alpha 2 ELISA Kit

Sign In for Pricing
View Details