Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NLRP3 Protein

This Human NLRP3 Protein spans the amino acid sequence from region 733-1036aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Angiotensin/vasopressin receptor AII/AVP-like) (Caterpiller protein 1.1) (CLR1.1) (Cold-induced autoinflammatory syndrome 1 protein) (Cryopyrin) (PYRIN-containing APAF1-like protein 1)

UniProt

Q96P20

Expression Region

733-1036aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glyceryl-d5 Iodide
451314-01 2.5 mg

Glyceryl-d5 Iodide

Sign In for Pricing
View Details
Glyceryl-d5 Iodide
451314-02 5 mg

Glyceryl-d5 Iodide

Sign In for Pricing
View Details
RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2, FLJ39093, FLJ40023, FLJ43262, SCR3) (APC)
250959-APC 100 µL

RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2, FLJ39093, FLJ40023, FLJ43262, SCR3) (APC)

Sign In for Pricing
View Details
SIRT5 Peptide
MBS3225943-01 0.1 mg

SIRT5 Peptide

Sign In for Pricing
View Details
SIRT5 Peptide
MBS3225943-02 5x 0.1 mg

SIRT5 Peptide

Sign In for Pricing
View Details
Mapk8 (NM_016700) Mouse Tagged ORF Clone Lentiviral Particle
MR206802L3V 200 µL

Mapk8 (NM_016700) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details