Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotalus atrox Phospholipase A2 Protein

This Crotalus atrox Phospholipase A2 Protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

P0CV89

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Crotalus atrox (Western diamondback rattlesnake)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Profilin 2 (PFN2) (C-term) Rabbit Polyclonal Antibody
AP53264PU-N 400 µL

Profilin 2 (PFN2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Imazamox
TRC-I268550-50MG 50 mg

Imazamox

Sign In for Pricing
View Details
CDPI3 Alkyne [Minor Groove Binder Alkyne]
6910-AAT 1 mg

CDPI3 Alkyne [Minor Groove Binder Alkyne]

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY265), CF594 conjugate, 0.1mg/mL
BNC940265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARHGEF5 Antibody
8C18395-AAT 50 µg

ARHGEF5 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629549 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details