Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotalus atrox Phospholipase A2 Protein

This Crotalus atrox Phospholipase A2 Protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

P0CV89

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Crotalus atrox (Western diamondback rattlesnake)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL
BNC470894-100 1x 100 µL

Melanoma Marker (PNL2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCEAL6 (NM_001006938) Human Recombinant Protein
TP309924 20 µg

TCEAL6 (NM_001006938) Human Recombinant Protein

Sign In for Pricing
View Details
FNBP1L Human Gene Knockout Kit (CRISPR)
KN417933 1 Kit

FNBP1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTA2 Rabbit Monoclonal Antibody
TA423137 100 µL

MTA2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CCNB1 (phospho S126) Antibody
RC-7015-01 50 μL

Recombinant CCNB1 (phospho S126) Antibody

Sign In for Pricing
View Details
Recombinant CCNB1 (phospho S126) Antibody
RC-7015-02 100 µL

Recombinant CCNB1 (phospho S126) Antibody

Sign In for Pricing
View Details