Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotalus atrox Phospholipase A2 Protein

This Crotalus atrox Phospholipase A2 Protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

P0CV89

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Crotalus atrox (Western diamondback rattlesnake)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF733P Human qPCR Primer Pair (NR_003952)
HP220631 200 Reactions

ZNF733P Human qPCR Primer Pair (NR_003952)

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF568 conjugate, 0.1mg/mL
BNC682231-100 1x 100 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USP25 (C-term) Rabbit Polyclonal Antibody
AP12046PU-N 400 µL

USP25 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CORO1B Rabbit Polyclonal Antibody
TA368028 100 µL

CORO1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cav3 Mouse Gene Knockout Kit (CRISPR)
KN502591 1 Kit

Cav3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRIA4 (Center) Rabbit Polyclonal Antibody
AP51950PU-N 400 µL

GRIA4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details