Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MleA Protein

This mleA Protein spans the amino acid sequence from region 260-516aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MLE)

UniProt

Q48796

Expression Region

260-516aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Oenococcus oeni (Leuconostoc oenos)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGTGIVVLAGVLGALKISGQKLTDQTYMSFGAGTAGMGIVKQLHEEMVEQGLSDEEAKKHFFLVDKQGLLFDDDPDLTPEQKPFAAKRSDFKNANQLTNLQAAVEAVHPTILVGTSTHPNSFTEEIVKDMSGYTERPIIFPISNPTKLAEAKAEDVLKWSNGKALIGTGVPVDDIEYEGNAYQIGQANNALIYPGLGFGAIAAQSKLLTPEMISAAAHSLGGIVDTTKVGAAVLPPVSKLADFSRTVAVAVAKKAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCI CRISPR/Cas9 KO Plasmid (h)
sc-402229 20 µg

FANCI CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human Cluster of Differentiation 86 ELISA
GTR10375637 96 Well

Human Cluster of Differentiation 86 ELISA

Sign In for Pricing
View Details
STAP2 (NM_017720) Human Tagged ORF Clone Lentiviral Particle
RC222763L4V 200 µL

STAP2 (NM_017720) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCDC88C Antibody
E313573 200 µL

CCDC88C Antibody

Sign In for Pricing
View Details
TNFRSF17 Antibody
E19-10193-1 50 µg - 50 µL

TNFRSF17 Antibody

Sign In for Pricing
View Details
Melanoma Inhibitory Activity Rabbit Polyclonal Antibody (Cy3)
orb978559 100 µL

Melanoma Inhibitory Activity Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details