Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MleA Protein

This mleA Protein spans the amino acid sequence from region 260-516aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MLE)

UniProt

Q48796

Expression Region

260-516aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Oenococcus oeni (Leuconostoc oenos)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGTGIVVLAGVLGALKISGQKLTDQTYMSFGAGTAGMGIVKQLHEEMVEQGLSDEEAKKHFFLVDKQGLLFDDDPDLTPEQKPFAAKRSDFKNANQLTNLQAAVEAVHPTILVGTSTHPNSFTEEIVKDMSGYTERPIIFPISNPTKLAEAKAEDVLKWSNGKALIGTGVPVDDIEYEGNAYQIGQANNALIYPGLGFGAIAAQSKLLTPEMISAAAHSLGGIVDTTKVGAAVLPPVSKLADFSRTVAVAVAKKAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth/Differentiation Factor 6 (GDF6) Human ELISA Kit
D8652 96 Tests

Growth/Differentiation Factor 6 (GDF6) Human ELISA Kit

Sign In for Pricing
View Details
Human amyloid beta peptide 1-42,Aβ1-42 ELISA KIT
JOT-EK1264Hu 96 wells

Human amyloid beta peptide 1-42,Aβ1-42 ELISA KIT

Sign In for Pricing
View Details
FARP1 Antibody
orb2677266-01 50 µL

FARP1 Antibody

Sign In for Pricing
View Details
FARP1 Antibody
orb2677266-02 100 µL

FARP1 Antibody

Sign In for Pricing
View Details
FARP1 Antibody
orb2677266-03 200 µL

FARP1 Antibody

Sign In for Pricing
View Details
HS6ST3 ORF Vector (Human) (pORF)
23921011 1.0 µg DNA

HS6ST3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details