Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MleA Protein

This mleA Protein spans the amino acid sequence from region 260-516aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MLE)

UniProt

Q48796

Expression Region

260-516aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Oenococcus oeni (Leuconostoc oenos)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGTGIVVLAGVLGALKISGQKLTDQTYMSFGAGTAGMGIVKQLHEEMVEQGLSDEEAKKHFFLVDKQGLLFDDDPDLTPEQKPFAAKRSDFKNANQLTNLQAAVEAVHPTILVGTSTHPNSFTEEIVKDMSGYTERPIIFPISNPTKLAEAKAEDVLKWSNGKALIGTGVPVDDIEYEGNAYQIGQANNALIYPGLGFGAIAAQSKLLTPEMISAAAHSLGGIVDTTKVGAAVLPPVSKLADFSRTVAVAVAKKAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP7 Human shRNA Lentiviral Particle (Locus ID 57337)
TL301771V 500 µL Each

SENP7 Human shRNA Lentiviral Particle (Locus ID 57337)

Sign In for Pricing
View Details
NT1-O12B
BA7475-5 5 mg

NT1-O12B

Sign In for Pricing
View Details
Pdcd-10 Lentiviral Activation Particles (m2)
sc-425154-LAC-2 200 µL

Pdcd-10 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
HCV NS5a (Hepatitis C NS5a)
301518 100 µg

HCV NS5a (Hepatitis C NS5a)

Sign In for Pricing
View Details
CD163 Antibody
orb1284283 100 µL

CD163 Antibody

Sign In for Pricing
View Details
Recombinant Mouse GAS1 Protein, N-GST & C-His
orb3056741-01 50 µg

Recombinant Mouse GAS1 Protein, N-GST & C-His

Sign In for Pricing
View Details