Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blomia tropicalis Major allergen Blo t 12 Protein

This Blomia tropicalis Major allergen Blo t 12 Protein spans the amino acid sequence from region 21-144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(allergen Blo t 12)

UniProt

Q17282

Expression Region

21-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Blomia tropicalis (Mite)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADEQTTRGRHTEPDDHHEKPTTQCTHEETTSTQHHHEEVVTTQTPHHEEKTTTEETHHSDDLIVHEGGKTYHVVCHEEGPIHIQEMCNKYIICSKSGSLWYITVMPCSIGTKFDPISRNCVLDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-5-acetoxytryptamine
TRC-N298525-500MG 500 mg

N-Acetyl-5-acetoxytryptamine

Sign In for Pricing
View Details
alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 4C9-6H6-4F7]
TA385483 100 µL

alpha Tubulin (TUBA4A) Mouse Monoclonal Antibody [Clone ID: 4C9-6H6-4F7]

Sign In for Pricing
View Details
UBTD2 Human Gene Knockout Kit (CRISPR)
KN414938 1 Kit

UBTD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POC5 (NM_152408) Human Recombinant Protein
TP311731M 100 µg

POC5 (NM_152408) Human Recombinant Protein

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[TU27]
E-AB-F11510P-01 25 µg

Purified Anti-Human CD122 Antibody[TU27]

Sign In for Pricing
View Details
Purified Anti-Human CD122 Antibody[TU27]
E-AB-F11510P-02 100 µg

Purified Anti-Human CD122 Antibody[TU27]

Sign In for Pricing
View Details