Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Blomia tropicalis Fatty acid-binding Protein

This Blomia tropicalis Fatty acid-binding Protein spans the amino acid sequence from region 1-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Bt6) (allergen Blo t 13)

UniProt

Q17284

Expression Region

1-130aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Blomia tropicalis (Mite)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPIEGKYKLEKSDNFDKFLDELGVGFMVKTAAKTLKPTLEVDVQGDTYVFRSLSTFKNTEIKFKLGEEFEEDRADGKRVKTVVNKEGDNKFIQTQYGDKEVKIVRDFQGDDVVVTASVGDVTSVRTYKRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Skp1 (NM_001007608) Rat Tagged Lenti ORF Clone
RR206545L4 10 µg

Skp1 (NM_001007608) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Genorise® recombinant Mouse 14-3-3 theta protein
GR124152 5 µg

Genorise® recombinant Mouse 14-3-3 theta protein

Sign In for Pricing
View Details
Creatine kinase-M (h2) -PR
sc-43700-PR 10 µM - 20 µL

Creatine kinase-M (h2) -PR

Sign In for Pricing
View Details
TMED6 Antibody, Biotin conjugated
CSB-PA840991LD01HU-01 50 µg

TMED6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TMED6 Antibody, Biotin conjugated
CSB-PA840991LD01HU-02 100 µg

TMED6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Monoclonal UCP1 Antibody (Vab12 P4B12/A12) [Alexa Fluor 647]
NBP2-50343AF647 0.1 mL

Mouse Monoclonal UCP1 Antibody (Vab12 P4B12/A12) [Alexa Fluor 647]

Sign In for Pricing
View Details