Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAH1 Protein

This IAH1 Protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P41734

Expression Region

1-238aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWALKILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIGPGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDAWQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNIH3 (Protein Cornichon Homolog 3, CNIH-3, FLJ38993)
125123 100 µg

CNIH3 (Protein Cornichon Homolog 3, CNIH-3, FLJ38993)

Sign In for Pricing
View Details
FGF10 Knockout HEK293T Polyclonal Cells
ARG4514 1 Million

FGF10 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Influenza A virus Polymerase acidic (PA) (HRP)
320443-01 50 µg

Influenza A virus Polymerase acidic (PA) (HRP)

Sign In for Pricing
View Details
Influenza A virus Polymerase acidic (PA) (HRP)
320443-02 100 µg

Influenza A virus Polymerase acidic (PA) (HRP)

Sign In for Pricing
View Details
QuicKey Human Cys-C (Cystatin C) ELISA Kit
MBS2557057-01 24 Tests

QuicKey Human Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details
QuicKey Human Cys-C (Cystatin C) ELISA Kit
MBS2557057-02 48 Test

QuicKey Human Cys-C (Cystatin C) ELISA Kit

Sign In for Pricing
View Details