Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pvalb Protein

This Mouse Pvalb Protein spans the amino acid sequence from region 2-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P32848

Expression Region

2-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200R (CD200R1) (NM_138939) Human Tagged ORF Clone Lentiviral Particle
RC218649L3V 200 µL

CD200R (CD200R1) (NM_138939) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tbc1d14 (NM_133910) Mouse Tagged ORF Clone
MR209982 10 µg

Tbc1d14 (NM_133910) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SLS Lab Basics 8 Channel Pipette 20 - 200uL
SLS4922 1 Each

SLS Lab Basics 8 Channel Pipette 20 - 200uL

Sign In for Pricing
View Details
TMEM176A Polyclonal Antibody, PE-Cy7 Conjugated
bs-13623R-PE-Cy7 100 µL

TMEM176A Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Monkey Tumor Necrosis Factor Ligand Superfamily Member 13 (APRIL) High-Sensitivity ELISA Kit
MBS8420245-01 1 Kit

Monkey Tumor Necrosis Factor Ligand Superfamily Member 13 (APRIL) High-Sensitivity ELISA Kit

Sign In for Pricing
View Details
Monkey Tumor Necrosis Factor Ligand Superfamily Member 13 (APRIL) High-Sensitivity ELISA Kit
MBS8420245-02 5x 1 Kit

Monkey Tumor Necrosis Factor Ligand Superfamily Member 13 (APRIL) High-Sensitivity ELISA Kit

Sign In for Pricing
View Details