Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pvalb Protein

This Mouse Pvalb Protein spans the amino acid sequence from region 2-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P32848

Expression Region

2-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf125 Polyclonal Antibody, FITC Conjugated
bs-9777R-FITC 100 µL

C1orf125 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NSMCE1 Rabbit Polyclonal Antibody (Biotin)
orb2120767 100 µL

NSMCE1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TBX18 Antibody - middle region : HRP (ARP36310_P050-HRP)
ARP36310_P050-HRP 100 µL

TBX18 Antibody - middle region : HRP (ARP36310_P050-HRP)

Sign In for Pricing
View Details
LOC688000 3'UTR GFP Stable Cell Line
TU261626 1.0 mL

LOC688000 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Shewanella sp. Bifunctional protein GlmU (glmU)
MBS1085359-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Bifunctional protein GlmU (glmU)
MBS1085359-02 0.02 mg (Yeast)

Recombinant Shewanella sp. Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details