Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VHL Protein (Biotin)

This Human VHL Protein (Biotin) spans the amino acid sequence from region 1-213aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein G7 pVHL

UniProt

P40337

Expression Region

1-213aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

60nm Carboxylated (carboxyl-PEG5000-SH) Silver Nanoparticles
SC5K-60-50 1 mL

60nm Carboxylated (carboxyl-PEG5000-SH) Silver Nanoparticles

Sign In for Pricing
View Details
GS143
BA7380-100 100 mg

GS143

Sign In for Pricing
View Details
Anti-Human LIN28B Polyclonal Antibody
HC186014-01 50 µg

Anti-Human LIN28B Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human LIN28B Polyclonal Antibody
HC186014-02 100 µg

Anti-Human LIN28B Polyclonal Antibody

Sign In for Pricing
View Details
Vmn1r226 sgRNA CRISPR Lentivector set (Mouse)
K3034601 3x 1.0 µg

Vmn1r226 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Nxf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3641305 3x 1.0 µg

Nxf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details