Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PagC Protein

This pagC Protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D4HWE3

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Erwinia amylovora (strain CFBP1430)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OST3A Polyclonal Antibody
MBS9003869 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OST3A Polyclonal Antibody

Sign In for Pricing
View Details
SNAX1 siRNA Oligos set (Human)
44540171 3x 5 nmol

SNAX1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Canine Gem-associated protein 2 ELISA kit
GTR10435053 96 Well

Canine Gem-associated protein 2 ELISA kit

Sign In for Pricing
View Details
SOS1 Rabbit Polyclonal Antibody (Fluoro488)
orb3116615 100 µg

SOS1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Rabbit Monoclonal CXCR1/IL-8RA Antibody (SE2) [DyLight 680]
NBP3-12003FR 0.1 mL

Rabbit Monoclonal CXCR1/IL-8RA Antibody (SE2) [DyLight 680]

Sign In for Pricing
View Details
AMBP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0079507 1.0 µg DNA

AMBP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details