Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PagC Protein

This pagC Protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D4HWE3

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Erwinia amylovora (strain CFBP1430)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin (FSCN1) (NM_003088) Human Tagged ORF Clone Lentiviral Particle
RC203031L1V 200 µL

Fascin (FSCN1) (NM_003088) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KIRREL2 Human Gene Knockout Kit (CRISPR)
KN415296 1 Kit

KIRREL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mastl (Center) (Mouse) Rabbit pAb
E2612673 100 µL

Mastl (Center) (Mouse) Rabbit pAb

Sign In for Pricing
View Details
CHRM4 Antibody
E11-208G 100 µg

CHRM4 Antibody

Sign In for Pricing
View Details
Recombinant Human SOST
P6526-01 50 µg

Recombinant Human SOST

Sign In for Pricing
View Details
Recombinant Human SOST
P6526-02 200 µg

Recombinant Human SOST

Sign In for Pricing
View Details