Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PagC Protein

This pagC Protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D4HWE3

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Erwinia amylovora (strain CFBP1430)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trk B (Phospho-Tyr515) Antibody
orb128471-01 25 µg

Trk B (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
Trk B (Phospho-Tyr515) Antibody
orb128471-02 50 µg

Trk B (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
Trk B (Phospho-Tyr515) Antibody
orb128471-03 100 µg

Trk B (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
Trk B (Phospho-Tyr515) Antibody
orb128471-04 200 µg

Trk B (Phospho-Tyr515) Antibody

Sign In for Pricing
View Details
Human Interleukin 35 (IL-35) Elisa Kit
EK710297 96 Well

Human Interleukin 35 (IL-35) Elisa Kit

Sign In for Pricing
View Details
GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 550)
MBS6300792-01 0.1 mL

GABBR2, CT (GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, G-protein coupled receptor 51, HG20) (MaxLight 550)

Sign In for Pricing
View Details