Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PagC Protein

This pagC Protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D4HWE3

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Erwinia amylovora (strain CFBP1430)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSHALSIGYAQSRVQDFNNLRGVNVKYRYEPESLLGVITSFSYMSAGGNVFDSSSWEDTYYDDSVKVKYFSLLVGPAYRINKHVSLYAVGGISNGKSALTQNYRHSNYTYTENSTDNTTSLAYGAGVQINPLENIVLDISYEGSKLQQTKINGFSMGIGYHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2-IN-17
MBS5804315 Inquire

SARS-CoV-2-IN-17

Sign In for Pricing
View Details
8-iso prostaglandin F2α (8-iso-PGF2a) Rat ELISA Kit
90552 96 Tests

8-iso prostaglandin F2α (8-iso-PGF2a) Rat ELISA Kit

Sign In for Pricing
View Details
ALDH3B2, CT (ALDH3B2, ALDH8, Aldehyde dehydrogenase family 3 member B2, Aldehyde dehydrogenase 8) (AP) discontinued
031773-AP 200 µL

ALDH3B2, CT (ALDH3B2, ALDH8, Aldehyde dehydrogenase family 3 member B2, Aldehyde dehydrogenase 8) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Treponema Pallidum TP_0617 Protein (aa 1-92)
VAng-Cr1388-1mgEcoli 1 mg (E. coli)

Recombinant Treponema Pallidum TP_0617 Protein (aa 1-92)

Sign In for Pricing
View Details
JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone Lentiviral Particle
RC222925L4V 200 µL

JNK1 (MAPK8) (NM_139049) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SV40T discontinued
376808 500 µg

SV40T discontinued

Sign In for Pricing
View Details