Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PagC Protein

This pagC Protein spans the amino acid sequence from region 24-185aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

D2T690

Expression Region

24-185aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSHALSIGYAQSRVQDFKNLRGVNLKYRYEPNSLLGVITSFSYMSAGGHEFDSLSWGDTYYDDRIKVKYYSLLIGPSYRINKYVSLYAVSGLGSSKLDLTQNYRHTNYTYTEHTASNTTSFAYGAGVQINPLKNIAIDISYEKSKINAKKINGFSMGIGYHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSG101, NT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (Biotin)
MBS6503997-01 0.2 mL

TSG101, NT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (Biotin)

Sign In for Pricing
View Details
TSG101, NT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (Biotin)
MBS6503997-02 5x 0.2 mL

TSG101, NT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (Biotin)

Sign In for Pricing
View Details
FLAG Tag antibody
70R-10687 1 mL

FLAG Tag antibody

Sign In for Pricing
View Details
Phospho-RGS19 (Ser151) Rabbit Polyclonal Antibody (PE-Cy5)
orb878788 100 µL

Phospho-RGS19 (Ser151) Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
3-Chloro-5-phenylbenzene-1-sulfonyl chloride
HJC21227-01 50 mg

3-Chloro-5-phenylbenzene-1-sulfonyl chloride

Sign In for Pricing
View Details
3-Chloro-5-phenylbenzene-1-sulfonyl chloride
HJC21227-02 0.5 g

3-Chloro-5-phenylbenzene-1-sulfonyl chloride

Sign In for Pricing
View Details