Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP2K Protein

This Human BMP2K Protein spans the amino acid sequence from region 39-344aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BIKe)

UniProt

Q9NSY1

Expression Region

39-344aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD42b/GPIb alpha Antibody (486805) [Janelia Fluor 525]
FAB4067JF525 0.1 mL

Mouse Monoclonal CD42b/GPIb alpha Antibody (486805) [Janelia Fluor 525]

Sign In for Pricing
View Details
LRRC37A3 Protein Vector (Human) (pPM-C-HA)
PV092476 500 ng

LRRC37A3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FAM53A Protein Vector (Mouse) (pPM-C-His)
PV177933 500 ng

FAM53A Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Guanosine-3',5'-bisphosphate
orb3169435 5 x 100 ul

Guanosine-3',5'-bisphosphate

Sign In for Pricing
View Details
PSG3 siRNA (Human)
orb1864437-01 15 nmol

PSG3 siRNA (Human)

Sign In for Pricing
View Details
PSG3 siRNA (Human)
orb1864437-02 30 nmol

PSG3 siRNA (Human)

Sign In for Pricing
View Details