Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Interferon alpha-1 Protein

This Bovine Interferon alpha-1 Protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P07348

Expression Region

24-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAVWDESLLDRLRTALDQQLTDLQACLR QEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTNLQERFRRKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf60 (TYW5) (NM_001039693) Human Over-expression Lysate
LC421890 20 µg

C2orf60 (TYW5) (NM_001039693) Human Over-expression Lysate

Sign In for Pricing
View Details
c Kit (KIT) Rabbit Polyclonal Antibody
AP09513PU-N 100 µL

c Kit (KIT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRAP2 Human qPCR Primer Pair (NM_138409)
HP216964 200 Reactions

MRAP2 Human qPCR Primer Pair (NM_138409)

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF647 conjugate, 0.1mg/mL
BNC472597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Galectin 7 (GAL7) ELISA Kit
RDR-GAL7-Mu-01 96 Tests

Mouse Galectin 7 (GAL7) ELISA Kit

Sign In for Pricing
View Details
Mouse Galectin 7 (GAL7) ELISA Kit
RDR-GAL7-Mu-02 48 Tests

Mouse Galectin 7 (GAL7) ELISA Kit

Sign In for Pricing
View Details