Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cxcl15 Protein

This Mouse Cxcl15 Protein spans the amino acid sequence from region 26-167aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Lungkine) (Small-inducible cytokine B15)

UniProt

Q9WVL7

Expression Region

26-167aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DNA Polymerase beta Antibody [Janelia Fluor 549]
NBP3-05939JF549 0.1 mL

Rabbit Polyclonal DNA Polymerase beta Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
NOG sgRNA CRISPR Lentivector (Human) (Target 1)
K1438802 1.0 µg DNA

NOG sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
FAM30B Adenovirus (Human)
20001051 1.0 mL

FAM30B Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral mouse Dnmbp shRNA (UAS) - Lentiviral mouse Dnmbp shRNA (UAS) (100)
GTR15249894 1 Vial

Lentiviral mouse Dnmbp shRNA (UAS) - Lentiviral mouse Dnmbp shRNA (UAS) (100)

Sign In for Pricing
View Details
LasA Antibody, HRP conjugated
CSB-PA318588LB01EZX-01 50 µg

LasA Antibody, HRP conjugated

Sign In for Pricing
View Details
LasA Antibody, HRP conjugated
CSB-PA318588LB01EZX-02 100 µg

LasA Antibody, HRP conjugated

Sign In for Pricing
View Details