Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PncA Protein

This pncA Protein spans the amino acid sequence from region 1-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nicotinamide deamidase) (NAMase) (Pyrazinamidase) (PZAase)

UniProt

P21369

Expression Region

1-213aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSME1 (11S Regulator Complex alpha Subunit, 11S Regulator Complex Subunit alpha, 29kD MCP Activator Subunit, 29kD MCP Activator Subunit, Activator of multicatalytic Protease Subunit 1, IFI5111, IGUP I-5111, Interferon gamma IEF SSP 5111, Interferon gamma inducible Protein 5111, Interferon gamma up Regulated I 5111 Protein, Interferon gamma up-Regulated I-5111 Protein, MGC8628, PA28a, PA28alpha, Proteasome (prosome, macropain) Activator Subunit 1 (PA28 alpha), Proteasome Activator 28 Subunit alpha, Proteasome Activator Complex Subunit 1, Proteasome Activator Subunit 1, PSME1, PSME1_HUMAN, REG-alpha, REGalpha, ) discontinued
225317-01 50 µL

PSME1 (11S Regulator Complex alpha Subunit, 11S Regulator Complex Subunit alpha, 29kD MCP Activator Subunit, 29kD MCP Activator Subunit, Activator of multicatalytic Protease Subunit 1, IFI5111, IGUP I-5111, Interferon gamma IEF SSP 5111, Interferon gamma inducible Protein 5111, Interferon gamma up Regulated I 5111 Protein, Interferon gamma up-Regulated I-5111 Protein, MGC8628, PA28a, PA28alpha, Proteasome (prosome, macropain) Activator Subunit 1 (PA28 alpha), Proteasome Activator 28 Subunit alpha, Proteasome Activator Complex Subunit 1, Proteasome Activator Subunit 1, PSME1, PSME1_HUMAN, REG-alpha, REGalpha, ) discontinued

Sign In for Pricing
View Details
PSME1 (11S Regulator Complex alpha Subunit, 11S Regulator Complex Subunit alpha, 29kD MCP Activator Subunit, 29kD MCP Activator Subunit, Activator of multicatalytic Protease Subunit 1, IFI5111, IGUP I-5111, Interferon gamma IEF SSP 5111, Interferon gamma inducible Protein 5111, Interferon gamma up Regulated I 5111 Protein, Interferon gamma up-Regulated I-5111 Protein, MGC8628, PA28a, PA28alpha, Proteasome (prosome, macropain) Activator Subunit 1 (PA28 alpha), Proteasome Activator 28 Subunit alpha, Proteasome Activator Complex Subunit 1, Proteasome Activator Subunit 1, PSME1, PSME1_HUMAN, REG-alpha, REGalpha, ) discontinued
225317-02 100 µL

PSME1 (11S Regulator Complex alpha Subunit, 11S Regulator Complex Subunit alpha, 29kD MCP Activator Subunit, 29kD MCP Activator Subunit, Activator of multicatalytic Protease Subunit 1, IFI5111, IGUP I-5111, Interferon gamma IEF SSP 5111, Interferon gamma inducible Protein 5111, Interferon gamma up Regulated I 5111 Protein, Interferon gamma up-Regulated I-5111 Protein, MGC8628, PA28a, PA28alpha, Proteasome (prosome, macropain) Activator Subunit 1 (PA28 alpha), Proteasome Activator 28 Subunit alpha, Proteasome Activator Complex Subunit 1, Proteasome Activator Subunit 1, PSME1, PSME1_HUMAN, REG-alpha, REGalpha, ) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ATPB Antibody (OTI4E5) [mFluor Violet 450 SE]
NBP2-70224MFV450 0.1 mL

Mouse Monoclonal ATPB Antibody (OTI4E5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
HMGCR discontinued
390019 200 µL

HMGCR discontinued

Sign In for Pricing
View Details
Goat Cell surface A33 antigen (GPA33) ELISA Kit
GTR10330277 96 Well

Goat Cell surface A33 antigen (GPA33) ELISA Kit

Sign In for Pricing
View Details
4-Phenylmethanesulfonylaniline
SBA49799-01 50 mg

4-Phenylmethanesulfonylaniline

Sign In for Pricing
View Details