Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccr2 Protein

This Mouse Ccr2 Protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC receptor) (MCP-1 receptor) (CD antigen CD192)

UniProt

P51683

Expression Region

1-55aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC56 3'UTR GFP Stable Cell Line
TU053630 1.0 mL

CCDC56 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SETD8P1 sgRNA CRISPR Lentivector set (Human)
K2128701 3x 1.0 µg

SETD8P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human PRR20C Protein
E30P9820 20 µg

Recombinant Human PRR20C Protein

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)
MBS2136165-01 0.1 mL

Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)
MBS2136165-02 0.2 mL

Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)

Sign In for Pricing
View Details
Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)
MBS2136165-03 0.5 mL

Biotin Linked Polyclonal Antibody to Thrombospondin 4 (THBS4)

Sign In for Pricing
View Details