Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRR Protein

This Human SRR Protein spans the amino acid sequence from region 1-340aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

D-serine ammonia-lyase D-serine dehydratase L-serine ammonia-lyase L-serine dehydratase

UniProt

Q9GZT4

Expression Region

1-340aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STH siRNA
abx935443-01 15 nmol

Human STH siRNA

Sign In for Pricing
View Details
Human STH siRNA
abx935443-02 30 nmol

Human STH siRNA

Sign In for Pricing
View Details
IL1RAP (Interleukin 1 Receptor Accessory Protein, C3orf13, FLJ37788, IL-1RAcP, IL1R3) (Biotin)
247559-Biotin 100 µL

IL1RAP (Interleukin 1 Receptor Accessory Protein, C3orf13, FLJ37788, IL-1RAcP, IL1R3) (Biotin)

Sign In for Pricing
View Details
ZNF259 (ZPR1) (NM_003904) Human Untagged Clone
SC324610 10 µg

ZNF259 (ZPR1) (NM_003904) Human Untagged Clone

Sign In for Pricing
View Details
Cabc1, ID (Adck3, Cabc1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Biotin)
MBS6280267-01 0.2 mL

Cabc1, ID (Adck3, Cabc1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Biotin)

Sign In for Pricing
View Details
Cabc1, ID (Adck3, Cabc1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Biotin)
MBS6280267-02 5x 0.2 mL

Cabc1, ID (Adck3, Cabc1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Biotin)

Sign In for Pricing
View Details