Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HypA Protein

This hypA Protein spans the amino acid sequence from region 206-390aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q46205

Expression Region

206-390aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Clostridium perfringens (strain 13 / Type A)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLTYEEFVEFHKKYYHPSNSYIFLYGNGDTEKELEFINEEYLKNFEYKEIDSEIKEQKSFESMKEESFTYGIAESEDLNHKSYYSLNFVIGDATDGEKGLAFDVLAYLLTRSTAAPLKKALIDAGIGKAVSGDFDNSTKQSAFTVLVKNAELNKEEEFKKVVMDTLKDLVENGIDKELIEASINR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PsaB | PSI-B core subunit of photosystem I
AS10 695 50 µg

Anti-PsaB | PSI-B core subunit of photosystem I

Sign In for Pricing
View Details
OATA00165-25UG - Mouse CD127 Antibody : Biotin
OATA00165-25UG 25 µg

OATA00165-25UG - Mouse CD127 Antibody : Biotin

Sign In for Pricing
View Details
Dctn2 ORF Vector (Mouse) (pORF)
ORF042725 1.0 µg DNA

Dctn2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Phospho-MCSF Receptor (Tyr561) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-18735R-BF405 100 µL

Phospho-MCSF Receptor (Tyr561) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TDT (C-Term) Rabbit pAb
MBS8551529-01 0.1 mL

TDT (C-Term) Rabbit pAb

Sign In for Pricing
View Details
TDT (C-Term) Rabbit pAb
MBS8551529-02 0.1 mL (AF405L)

TDT (C-Term) Rabbit pAb

Sign In for Pricing
View Details