Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit ARRB1 Protein

This Rabbit ARRB1 Protein spans the amino acid sequence from region 1-410aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Arrestin beta-1)

UniProt

Q95223

Expression Region

1-410aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGDKGTRVFKKASPNGKLTVYLGKRGFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPKLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPHPTAETTRLFLMSDKPLHLEASLDKEIYYHGEPIIVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLMREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEDDVTGSPRLNDR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPNT CRISPR All-in-one AAV vector set (with saCas9)(Human)
32092151 3x 1.0 µg DNA

NPNT CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole
OR1058834-01 100 mg

(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole

Sign In for Pricing
View Details
(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole
OR1058834-02 250 mg

(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole

Sign In for Pricing
View Details
(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole
OR1058834-03 1 g

(R) -4- (tert-Butyl) -2- (6-cyclopropylpyridin-2-yl) -4,5-dihydrooxazole

Sign In for Pricing
View Details
MRP-L14 shRNA Plasmid (m)
sc-149582-SH 20 µg

MRP-L14 shRNA Plasmid (m)

Sign In for Pricing
View Details
ICOSLG Polyclonal Conjugated Antibody
orb1617975 100 µL

ICOSLG Polyclonal Conjugated Antibody

Sign In for Pricing
View Details