Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL11A1 Protein

This Human COL11A1 Protein spans the amino acid sequence from region 532-699aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P12107

Expression Region

532-699aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-12 p35 (Interleukin 12 p35) BioAssayTM ELISA Kit (Rat) discontinued
383399 96 Tests

IL-12 p35 (Interleukin 12 p35) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
HTT Protein Vector (Mouse) (pPM-C-HA)
PV190352 500 ng

HTT Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Bcl-XL, XS
MBS642534-01 0.05 mL

Bcl-XL, XS

Sign In for Pricing
View Details
Bcl-XL, XS
MBS642534-02 5x 0.05 mL

Bcl-XL, XS

Sign In for Pricing
View Details
SSRP1, CT (SSRP1, FACT80, FACT complex subunit SSRP1, Chromatin-specific transcription elongation factor 80kD subunit, Facilitates chromatin transcription complex 80kD subunit, Facilitates chromatin transcription complex subunit SSRP1, Recombination signal sequence recognition protein 1, Structure-specific recognition protein 1, T160) (MaxLight 650) discontinued
042332-ML650 100 µL

SSRP1, CT (SSRP1, FACT80, FACT complex subunit SSRP1, Chromatin-specific transcription elongation factor 80kD subunit, Facilitates chromatin transcription complex 80kD subunit, Facilitates chromatin transcription complex subunit SSRP1, Recombination signal sequence recognition protein 1, Structure-specific recognition protein 1, T160) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Kininogen-1 light chain Rabbit pAb, BF555 conjugated
orb3001957 100 µL

Kininogen-1 light chain Rabbit pAb, BF555 conjugated

Sign In for Pricing
View Details