Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XylF Protein

This xylF Protein spans the amino acid sequence from region 1-281aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(HMSH) (2-hydroxymuconic semialdehyde hydrolase)

UniProt

P23106

Expression Region

1-281aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas putida (Arthrobacter siderocapsulatus)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNAPQQSPEIGREILAAGYRTNLHDQGEGFPALLIHGSGPASPPGPTGAGSFRSSQTRRVIAPDMLGFGYSERPADGKYSQARWVEHAIGVLDALGIQQGDIVGNSFGGGLALALAIRHPERVRRLVLMGSVGVSFPITAGLETAWGYTPSLANMRRLLDLFAHDRTLVNDELAELRYQASIRPGFQESFAAMFPPPRQNGVDDLASNETDIRALPNETLVIHGREDRIIPLQASLTLAQWIPNAQLHVFGQCGHWTQIEHAERFARLVENFLAEADALHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTM1 Protein Lysate (Human) with C-Ha Tag
30902031 100 µg

MTM1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
RGD1565989 (NM_001109182) Rat Untagged Clone
RN211597 10 µg

RGD1565989 (NM_001109182) Rat Untagged Clone

Sign In for Pricing
View Details
GFP Mouse Monoclonal Antibody [Clone ID: 9F9.F9]
TA397411S 25 µL

GFP Mouse Monoclonal Antibody [Clone ID: 9F9.F9]

Sign In for Pricing
View Details
COASY Protein Lysate (Human) with C-Ha Tag
16532031 100 µg

COASY Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
LTA Antibody
orb252319 100 µL

LTA Antibody

Sign In for Pricing
View Details
ELSPBP1 Antibody
E92151 100 µL

ELSPBP1 Antibody

Sign In for Pricing
View Details