Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmpA Protein

This ompA Protein spans the amino acid sequence from region 1734-2021aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

190KDA antigen Cell surface antigen rOmp A

UniProt

Q52657

Expression Region

1734-2021aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPA Antibody - N-terminal region : FITC (ARP60282_P050-FITC)
ARP60282_P050-FITC 100 µL

LPA Antibody - N-terminal region : FITC (ARP60282_P050-FITC)

Sign In for Pricing
View Details
Epigenase 5mC-Hydroxylase TET Activity/Inhibition Assay Kit (Fluorometric)
P-3087-96 96 Assays

Epigenase 5mC-Hydroxylase TET Activity/Inhibition Assay Kit (Fluorometric)

Sign In for Pricing
View Details
Acetyl-Histone H3-K18 Polyclonal Conjugated Antibody
C30870 100 µL

Acetyl-Histone H3-K18 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human MEOX2 Recombinant Protein (N-His-KSI)
HD061012-01 50 µg

Human MEOX2 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details
Human MEOX2 Recombinant Protein (N-His-KSI)
HD061012-02 100 µg

Human MEOX2 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details
Human MEOX2 Recombinant Protein (N-His-KSI)
HD061012-03 1 mg

Human MEOX2 Recombinant Protein (N-His-KSI)

Sign In for Pricing
View Details