Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANK3 Protein

This Human ANK3 Protein spans the amino acid sequence from region 4088-4199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ANK-3) (Ankyrin-G)

UniProt

Q12955

Expression Region

4088-4199aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC6 (NM_006044) Human Over-expression Lysate
LY401822 100 µg

HDAC6 (NM_006044) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse Chromosome-associated kinesin KIF4 (Kif4) , partial
MBS1063654 Inquire

Recombinant Mouse Chromosome-associated kinesin KIF4 (Kif4) , partial

Sign In for Pricing
View Details
LRFN1 Polyclonal Antibody, APC Conjugated
bs-12141R-APC 100 µL

LRFN1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Smc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4775808 1.0 µg DNA

Smc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
TGF-beta2, human recombinant
4340-5 5 µg

TGF-beta2, human recombinant

Sign In for Pricing
View Details
Recombinant Chlamydophila abortus GTPase Der (der)
MBS1332985-01 0.02 mg (E-Coli)

Recombinant Chlamydophila abortus GTPase Der (der)

Sign In for Pricing
View Details