Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Macrovipera lebetina obtusa Disintegrin obtustatin Protein

This Macrovipera lebetina obtusa Disintegrin obtustatin Protein spans the amino acid sequence from region 1-41aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P83469

Expression Region

1-41aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Macrovipera lebetina obtusa (Levant blunt-nosed viper) (Vipera lebetina obtusa)

Field of Research

Cancer, Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-500 1x 500 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL
BNC400495-500 1x 500 µL

SUMO-1 (SM1/495), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL
BNC042024-500 1x 500 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details