Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL4 Protein

This IL4 Protein spans the amino acid sequence from region 25-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-4) (B-cell stimulatory factor 1) (BSF-1) (Lymphocyte stimulatory factor 1)

UniProt

Q865X5

Expression Region

25-133aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Lama glama (Llama)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (FITC)
247604-FITC 100 µL

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (FITC)

Sign In for Pricing
View Details
CLN5 Polyclonal Antibody, FITC Conjugated
A68497-100 100 µL

CLN5 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
B3GAT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
12932066 1.0 µg DNA

B3GAT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TRNAC13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV751328 1.0 µg DNA

TRNAC13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse IL-10 ELISA kit (High Sensitivity)
E22-MC005 (H) .96 96 Tests

Mouse IL-10 ELISA kit (High Sensitivity)

Sign In for Pricing
View Details
PREP, ID (PREP, PEP, Prolyl endopeptidase, Post-proline cleaving enzyme) (MaxLight 405)
MBS6337154-01 0.1 mL

PREP, ID (PREP, PEP, Prolyl endopeptidase, Post-proline cleaving enzyme) (MaxLight 405)

Sign In for Pricing
View Details