Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UCN3 Protein

This Human UCN3 Protein spans the amino acid sequence from region 119-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Stresscopin) (Urocortin III) (Ucn III)

UniProt

Q969E3

Expression Region

119-161aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clinafloxacin Hydrochloride
TRC-C579000-1G 1 g

Clinafloxacin Hydrochloride

Sign In for Pricing
View Details
GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 30nm
CCG-1013-30 1 mL

GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 30nm

Sign In for Pricing
View Details
3,3'-Dichlorobenzidine Dihydrochloride
TRC-D431910-5G 5 g

3,3'-Dichlorobenzidine Dihydrochloride

Sign In for Pricing
View Details
SRY Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]
TA505268AM 100 µL

SRY Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
2-Bromo-1,4-dichlorobenzene
TRC-B683390-25G 25 g

2-Bromo-1,4-dichlorobenzene

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details